You signed in with another tab or window. Reload to refresh your session.You signed out in another tab or window. Reload to refresh your session.You switched accounts on another tab or window. Reload to refresh your session.Dismiss alert
Hi!
When I render a phylogeny with msas in Jupyter Notebook is it possible to improve the quality of the figure, without making it too large?
For example, running the following code produces the figure shown below:
import os
os.environ['QT_QPA_PLATFORM']='offscreen'
from ete3 import PhyloTree
fasta_txt = """
>seqA
MAEIPDETIQQFMALT---HNIAVQYLSEFGDLNEALNSYYASQTDDIKDRREEAH
>seqB
MAEIPDATIQQFMALTNVSHNIAVQY--EFGDLNEALNSYYAYQTDDQKDRREEAH
>seqC
MAEIPDATIQ---ALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQPDRREEAH
>seqD
MAEAPDETIQQFMALTNVSHNIAVQYLSEFGDLNEAL--------------REEAH
"""
# Load a tree and link it to an alignment.
t = PhyloTree("(((seqA,seqB),seqC),seqD);")
t.link_to_alignment(alignment=fasta_txt, alg_format="fasta")
t.render("%%inline",h=150,w=800)
reacted with thumbs up emoji reacted with thumbs down emoji reacted with laugh emoji reacted with hooray emoji reacted with confused emoji reacted with heart emoji reacted with rocket emoji reacted with eyes emoji
Uh oh!
There was an error while loading. Please reload this page.
Uh oh!
There was an error while loading. Please reload this page.
Hi!
When I render a phylogeny with msas in Jupyter Notebook is it possible to improve the quality of the figure, without making it too large?
For example, running the following code produces the figure shown below:
All reactions